DISCLAIMER: This product is strictly for research use only. It is meant solely for laboratory testing and in vitro studies-not for use in or on humans or animals. All details provided on this site are for educational purposes. It is illegal to introduce this substance into the body. Only licensed professionals should handle it. This item is not intended to be used as a drug, supplement, or cosmetic, and must not be misrepresented as such.
Semaglutide
Semaglutide is a medication originally developed to help regulate blood sugar in people with type 2 diabetes. It mimics a natural hormone in the body (GLP-1) that helps control appetite, insulin levels, and digestion. Recently, it has gained significant attention in research for its effects on weight loss and metabolic health.
Variant: 5 mg
Quantity: 1
All peptides arrive in powdered form for stability
What is Semaglutide?
Semaglutide is a GLP-1 receptor agonist originally developed to treat type 2 diabetes. It works by mimicking the body's natural GLP-1 hormone to regulate blood sugar, curb appetite, and slow digestion. In recent clinical trials, it has also shown powerful effects on long-term weight loss, leading to its FDA approval under the brand name Wegovy for chronic weight management.
Potential Benefits Shown in Studies
- Supporting long-term weight loss
- Reducing appetite and food cravings
- Controlling blood sugar levels
- Slowing digestion to help with fullness
- Supporting cardiovascular health
- Improving insulin sensitivity
- Lowering inflammation in metabolic tissues
Mechanisms of Action
Semaglutide exerts its effects by:
- Activating GLP-1 receptors in the pancreas and brain
- Stimulating insulin secretion in response to elevated blood glucose
- Suppressing glucagon release, lowering hepatic glucose output
- Slowing gastric emptying, which promotes a feeling of fullness
- Reducing appetite through action on brain regions that regulate hunger
Molecular Structure of Semaglutide
Sequence
HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG — with a modification at position 26 (Lys26 acylated with a C-18 fatty diacid chain for longer activity)
Molecular Properties
Semaglutide Research Highlights
In the STEP 1 trial, patients with obesity receiving Semaglutide 2.4 mg weekly lost an average of 14.9% of their body weight in 68 weeks — significantly outperforming the placebo group.
Semaglutide improves HbA1c levels, increases insulin sensitivity, and reduces the risk of cardiovascular events in people with type 2 diabetes.
GLP-1 analogs like Semaglutide have shown promise in reducing fatty liver, lowering LDL cholesterol, and improving markers of heart health.
Semaglutide reduces appetite and food intake by affecting reward-related brain areas, helping people naturally eat less without extreme restriction.
